PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG392700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YA
Protein Properties Length: 328aa    MW: 35967.5 Da    PI: 10.1069
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG392700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.83.6e-33170226158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh+hA++R Rg+gGrF
  Pavir.9KG392700.1.p 170 EEPIFVNAKQYHAILRRRQMRAKLEAQNKL-VKGRKPYLHESRHRHAMKRVRGPGGRF 226
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.0E-37168229IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.748169229IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.3E-28171226IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-24172194IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860174194IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.3E-24203226IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MMPSGNKMLL QEMDGDPFHT MQNYDFLSGN GYSMKQLIHS NSDKDSSSTK SEQSRQDLST  60
VSDSSLNGQH TPTQSDNNDS CGKRDQGMVK TILSFGNPEV AFSTQKFDHS QPFNLCSTYP  120
HLPSRLVLLI PLIRIISGAL TGYTSNAIVH PQINVAANSR VPLPIEPAAE EPIFVNAKQY  180
HAILRRRQMR AKLEAQNKLV KGRKPYLHES RHRHAMKRVR GPGGRFLNKK ELQEQQQQQK  240
ALPSLQTPTG GAGKMALCRN NLCSENSASH SSSTSSGISI VSNGGGMVAH HEHISFSSTS  300
FLPGMNFHAE NGGEKMAVHG VHRRTPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-23170248272NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210219RHRHAMKRVR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.160250.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984046.11e-169PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
TrEMBLK4AD021e-169K4AD02_SETIT; Uncharacterized protein
STRINGSi036728m1e-166(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.19e-30nuclear factor Y, subunit A6